PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.30275s0201.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 283aa    MW: 31584.7 Da    PI: 8.737
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.30275s0201.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.8e-19134188256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rk+ +++k+q  +Le+ F+++++++ +++  LAkklgLt rqV vWFqNrRa+ k
  Bostr.30275s0201.1.p 134 RKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTK 188
                           677889***********************************************98 PP

2HD-ZIP_I/II122.81.6e-39134223191
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rlsk+q+++LE++F+e+++L+p++K +la++Lgl++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rLeke +eLr 
  Bostr.30275s0201.1.p 134 RKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCVEKLTEENRRLEKEAAELR- 221
                           69*************************************************************************************9. PP

           HD-ZIP_I/II  90 el 91 
                           +l
  Bostr.30275s0201.1.p 222 AL 223
                           54 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.2E-26298IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.5E-18115188IPR009057Homeodomain-like
SuperFamilySSF466896.68E-19118191IPR009057Homeodomain-like
PROSITE profilePS5007117.135130190IPR001356Homeobox domain
SMARTSM003891.9E-17132194IPR001356Homeobox domain
PfamPF000461.5E-16134188IPR001356Homeobox domain
CDDcd000863.90E-16134191No hitNo description
PRINTSPR000317.5E-6161170IPR000047Helix-turn-helix motif
PROSITE patternPS000270165188IPR017970Homeobox, conserved site
PRINTSPR000317.5E-6170186IPR000047Helix-turn-helix motif
PfamPF021838.1E-8190224IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.8E-23190233IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010582Biological Processfloral meristem determinacy
GO:0048467Biological Processgynoecium development
GO:0080127Biological Processfruit septum development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MMMGKEDLGL SLRLGFAQNH HPLQLNLKPT SSSVSNLLMF PWNQTFVSSS DHQKQQFLRK  60
IDVNSLPTTV DLEEETGVLS PNSTISSTVS GKRRSEREGT SGGGAGDDLD ITLDRSSSRG  120
TSDEEEDYGG ETCRKKLRLS KDQSAVLEDT FKEHNTLNPK QKLALAKKLG LTARQVEVWF  180
QNRRARTKLK QTEVDCEYLK RCVEKLTEEN RRLEKEAAEL RALKLSPRLY GQMSPPTTLL  240
MCPSCERVAG PSSSNHSQQS VSLSPWLQMA HGSTFDVMRP RS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182190RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00050PBMTransfer from AT4G17460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412520.0AJ441252.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT1.
GenBankAK2285870.0AK228587.1 Arabidopsis thaliana mRNA for homeobox-leucine zipper protein HAT1, complete cds, clone: RAFL15-36-J21.
GenBankATU093320.0U09332.1 Arabidopsis thaliana clone HAT1 homeobox protein mRNA, complete cds.
GenBankAY0873220.0AY087322.1 Arabidopsis thaliana clone 34167 mRNA, complete sequence.
GenBankBT0057560.0BT005756.1 Arabidopsis thaliana clone RAFL15-36-J21 (R50164) putative homeobox-leucine zipper protein HAT1 (HD-Zip protein 1) (At4g17460) mRNA, complete cds.
GenBankBT0061120.0BT006112.1 Arabidopsis thaliana clone U50164 putative homeobox-leucine zipper protein HAT1 (HD-Zip protein 1) (At4g17460) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002870101.10.0homeobox-leucine zipper protein HAT1
SwissprotP466000.0HAT1_ARATH; Homeobox-leucine zipper protein HAT1
TrEMBLD7MBY60.0D7MBY6_ARALL; Homeobox-leucine zipper protein HAT1
STRINGscaffold_702713.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15632690
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17460.11e-163Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein